Bivalirudin Trifluoroacetate role

Bivalirudin Trifluoroacetate role with heparin, it does not rely on antithrombin 1V (NI1_ Ⅳ), heparin cofactor Ⅱ and so on. Thrombin plays a central role in the coagulation serine protease: it is the hydrolysis of fibrinogen to generate fibrin monomers; activation of coagulation factor X Ⅲ; promote crosslinking of fibrin clots to form a stable covalent structure. Meanwhile, thrombin activates factor V, Ⅷ; activates platelets promote platelet aggregation and granule release. This product can be hydrolyzed due to thrombin peptide sequence Arg3 and Pro4 peptide bond between, so that the product inactivation, so the product of thrombin inhibition is reversible and transient. In in vitro experiments, the product concentration-dependent manner to extend the healthy human plasma activated partial thromboplastin time (activated partial thromboplastin time, af T), thrombin time (thrombin time, 1vr), prothrombin time (prothrombin time, PT ). The goods and the free thrombin or thrombus thrombin binding without affecting platelet release substances. Trial in healthy volunteers show: This product dose and concentration-dependent manner activated clotting time extension (activated clotting time, ACT), af Ding, Prr and 1vr. Due to vascular occlusion ≥ 70% while receiving percutaneous transluminal coronary angioplasty (PTCA) in patients with coronary heart disease treatment given after the product is also available with the same anticoagulant effect of healthy people. In the generation after intravenous anticoagulant effect of this product, the patient's coagulation in about 1 h after discontinuation tended to be normal. 291 cases due to vascular occlusion greater than 70% while receiving PTCA in patients treated with the dose increased, the majority of patients with ACI, time to reach the 300 or 350S. iv 1 mg'kg this product, combined 2.5 mg · kg · h infusion for 4h, and then 0.2 mg · kg · h dose to maintain 14 to 20h, all patients A (vr values ​​exceed 300S.

More about:Bivalirudin Trifluoroacetate suppliers
From:natural food additive

Some information about Histrelin Acetate

Histrelin Acetate is an effective, long-lasting and synthetic non-peptide gonadotropin-releasing hormone analogues. It is more than endogenous gonadotropin-releasing hormone more effective. Long-term use of gonadotropin-releasing hormone agonists can reduce the number of pituitary gonadotropin receptors, also inhibits gonadotropin receptor stimulation. In the ovary, gonadotropin-releasing hormone agonist suppression steroid substances produced and reducing the number of gonadotropin receptors. Histrelin Acetate for central precocious puberty. Give proper daily dose of histrelin with central precocious puberty in boys make gonadotropin levels fall and testicular nucleic acids decrease. The girl in serum estradiol concentrations decreased to prepubertal levels, cessation of menstruation, linear growth, skeletal maturation and adult slow increase in height.

There are some indications that melatonin is involved in puberty. Nevertheless, with the Histrelin Acetate central precocious puberty in girls with estrogen reduced, but did not decrease the concentration of melatonin.

Indications:
For the treatment of central precocious puberty. Can also be used to treat endometriosis, polycystic ovarian disease, uterine leiomyoma. Also with estrogen or progesterone combined therapy of severe pre-menopausal syndrome. FDA alone can prevent acute intermittent porphyria.

Adverse reactions:
Clinical Trials common adverse reactions were injection site skin reactions (erythema, swelling and itching), vaginal bleeding, urticaria, purpura, convulsions frequency increases, visual clutter, hot flushes / flushing, swelling, mood changes, and behavioral disorder and fever , limb pain, fatigue, chills, malaise, neck, chest or trunk pain and viral infections, weight gain, head / facial pain, nausea and vomiting.

Contraindications:
Pregnant or potentially pregnant women and lactating women disabled histrelin. Hypersensitivity reaction to the drug people are disabled.



More about:Histrelin Acetate suppliers
From:natural food additive

GRF (human) Acetate basic information

Chinese name: Growing releasing hormone
Chinese Synonyms: Growing releasing hormone; promote release of adrenaline factor; acetic acid pro adrenaline-releasing factor (human); promoting adrenaline-releasing factor (human); TYR-ALA-ASP-ALA-ILE-PHE-THR-ASN-SER-TYR-ARG-LYS-VAL-LEU-GLY-GLN-LEU-SER-ALA-ARG-LYS-LEU-LEU-GLN-ASP-ILE-MET-SER-ARG-GLN-GLN-GLY-GLU-SER-ASN-GLN-GLU-ARG-GLY-ALA-ARG-ALA-ARG-LEU-NH2; GRF (human) Acetate
Name: GRF (1-44) (HUMAN)
English Synonyms: SERMORELIN (HUMAN); SOMATOCRININ (HUMAN); SOMATOLIBERIN (HUMAN); SOMATORELIN; YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL-NH2; TYR-ALA-ASP-ALA-ILE-PHE-THR-ASN-SER-TYR-ARG-LYS-VAL-LEU-GLY-GLN-LEU-SER-ALA-ARG-LYS-LEU-LEU-GLN-ASP-ILE-MET-SER-ARG-GLN-GLN-GLY-GLU-SER-ASN-GLN-GLU-ARG-GLY-ALA-ARG-ALA-ARG-LEU-NH2; H-TYR-ALA-ASP-ALA-ILE-PHE-THR-ASN-SER-TYR-ARG-LYS-VAL-LEU-GLY-GLN-LEU-SER-ALA-ARG-LYS-LEU-LEU-GLN-ASP-ILE-MET-SER-ARG-GLN-GLN-GLY-GLU-SER-ASN-GLN-GLU-ARG-GLY-ALA-ARG-ALA-ARG-LEU-NH2; H-TYR-ALA-ASP-ALA-ILE-PHE-THR-ASN-SER-TYR-ARG-LYS-VAL-LEU-GLY-GLN-LEU-SER-ALA-ARG-LYS-LEU-LEU-GLN-ASP-ILE-MET-SER-ARG-GLN-GLN-GLY-GLU-SER-ASN-GLN-GLU-ARG-GLY-ALA-ARG-ALA-ARG-LEU-OH
CAS: 83930-13-6
Formula: C215H358N72O66S1
MW: 5039.65
EINECS Number:
Related Categories: Peptide; peptide APIs; Peptide; VIP and PACAP receptor
Mol File: Mol File
The nature of the growth hormone release
Storage conditions -20 ° C



More about:GRF (human) Acetate suppliers
From:natural food additive

Some of the role of Endothelin 1

Endothelin (endothelin, ET) exists not only in vascular endothelium, is also widely present in various tissues and cells, is an important factor in regulating cardiovascular function, based on the maintenance of vascular tone and homeostasis plays an important role in the cardiovascular system. It is a polypeptide composed of 21 amino acids, a molecular weight of 2400D, N terminal position of the two cysteine ​​disulfide to connect 1-15,3-11, C is the number of hydrophobic amino terminal residues. N-terminal structure determines its receptor affinity, C-terminal receptor binding to determine their position. ET-1 and two isomers of the family that ET-2, ET-3, the difference is the individual amino acid residues play a major role in the cardiovascular is ET-1 (Endothelin 1). Endothelial cells are stimulated synthesis and release of ET-1, which is mainly regulated at the transcriptional level, stimulating ET-1 synthesis include: epinephrine, thromboxane, vasopressin, angiotensin, insulin, cytokines, and vascular wall shear force and the pressure change and the physico-chemical factors such as hypoxia, ET-1 stimulation of the synthesis process requires a Ca2 (-dependent protein kinase C (PKC) involved. inhibition of ET-1 synthesis factors: NO, PGI2, Atrial natriuretic peptide and heparin. ET-1 in plasma half-life is very short (<5min), quickly binds to receptors on the organization, its clear position mainly in the lungs and kidney, ET-degrading enzymes will soon be decomposed .

Role: endothelin (Endothelin, ET) is a Japanese scholar Yanagisawa, etc. from cultured porcine aortic endothelial cells, a kind of isolated and purified by a 21 amino acid residues of the peptide, endothelin is by far the most powerful vasoconstrictor known substances, their duration of action lasting, not for  receptors, H1 receptors and 5-HT receptor antagonist antagonist, may be isoproterenol, atrial natriuretic peptide and calcitonin gene-related peptide hormone suppression. Thus, endothelin is an endogenous vasoconstrictor long-acting regulatory factors. Endothelin there is a strong positive inotropic effect and vasoconstrictor reflex rise of blood pressure effects can also cause heart suppression, resulting in cardiac insufficiency. But also induced myocardial cell sugar overload, arrhythmias, and myocardial energy metabolism. Currently a large number of studies have shown hinder severe angina, AMI, myocardial 1 / R injury, percutaneous transluminal angioplasty ET synthesis and release of the body to increase significantly hinder, or vascular reactivity for ET hyperthyroidism, are likely to promote the development of the pathological process. The application of ET or ET antagonist antibody may be ischemic heart disease prevention.

Impact: The discovery of endothelin people on endothelial cells to further deepen the understanding that the endothelium is not only a semi-permeable membrane to maintain blood flow and exchange of material, is also a specialized regulatory organization, plays a signal receiving, processing and re-export of role for the maintenance of homeostasis plays an important regulatory role in circulation. Studies have shown that tissue hypoxia, oxidative metabolism can be enhanced and increased levels of catecholamine stimulation of endothelin original transcription. Angiotensin can promote the release of endothelin. In the heart and blood vessels have extensive endothelin receptors, endothelin receptor binding and tissue corresponding to activate the second information cGMP, secondary to increased levels of inositol triphosphate-induced increase in intracellular calcium, and exerts its biological effects .



More about:Endothelin 1 suppliers
From:Cytokines products

Testosterone decanoate some of the information

Abstract：We have investigated the pharmacokinetics and effects on the male reproductive axis of a novel preparation of testosterone decanoate (TD) with a progestogen implant. Twenty healthy Chinese men were administered TD (400 mg intramuscular 4 weekly) with two subcutaneous (SC) etonogestrel implants. Trough testosterone concentrations rose with repeated administration. Peak concentrations 1 week after the fourth injection were 31 +/- 2 nmol/liter. Both LH and FSH were rapidly suppressed and continued to fall during treatment. Spermatogenesis was also suppressed, to <or=1 x 10(6)/mL in all men with 16 (80%) azoospermic at 12 weeks. Treatment was associated with an increase in weight, and also increases in hemoglobin concentration (9%) and hematocrit (15%). No subjects withdrew from the study, although the study was terminated after subjects had completed 12 to 18 weeks as some men were found to have elevated liver enzyme tests. These data demonstrate that the pharmacokinetics of TD are improved compared to previous injectable testosterone preparations, although peak testosterone concentrations rise briefly into the supraphysiological range. The speed and degree of spermatogenic suppression suggest that this combination has promise as an effective male contraceptive.

More about:Testosterone decanoate Prices
From:Hormones product

About Methandrodtenolone Products

Methandrostenolone (trade names Averbol, Dianabol, Danabol), aswell accepted as metandienone (INN) or methandienone, is an orally-effective anabolic steroid originally developed in Germany and arise in the US in the aboriginal 1960s by Ciba Specialty Chemicals. Methandrostenolone is a controlled actuality in the United States and Western Europe and charcoal accepted a part of bodybuilders. An injectable anatomy is awash online from United States based companies. Methandrostenolone is readily accessible after a decree in countries such as Mexico (under the barter name Reforvit-b), and is aswell getting bogus in Asia and abounding East European countries.

Biophysiology:

Methandrostenolone does not acknowledge acerb with the androgen receptor but still exerts its furnishings through the androgen receptor in vivo.[4] These cover affecting increases in protein synthesis, glycogenolysis, and beef backbone over a abbreviate amplitude of time. In top doses (30 mg or added per day), ancillary furnishings such as gynecomastia, top claret pressure, abscess and macho arrangement alopecia may activate to occur. The biologic causes astringent masculinising furnishings in women even at low doses. In addition, it is metabolized into methylestradiol by aromatase. This agency that after the administering of aromatase inhibitors such as anastrozole or aminoglutethimide, estrogenic furnishings will arise over time in men. Abounding users will action the estrogenic ancillary furnishings with Arimidex, Nolvadex or Clomid. In addition, as with added 17α-alkylated steroids, the use of methandrostenolone over continued periods of time can aftereffect in alarmist accident after adapted care.

The 17α-methylation of the steroid does acquiesce it to canyon through the alarmist with alone a baby allocation of it torn down (hence causing the above accident to the liver) acceptance it to be able if taken orally. It aswell has the aftereffect of abbreviating the steroid's affection for sex hormone bounden globulin, a protein that de-activates steroid molecules and prevents them from added reactions with the body. As a result, methandrostenolone is decidedly added alive than an agnate abundance of testosterone, consistent in accelerated advance of beef tissue. However, the accessory acclivity in estrogen levels - a aftereffect of the aromatization of methandrostenolone - after-effects in cogent baptize retention. This gives the actualization of abundant assets in accumulation and strength, which prove to be acting already the steroid is discontinued and baptize weight drops. Because of this, it is generally acclimated by bodybuilders alone at the alpha of a "steroid cycle", to facilitate accelerated backbone increases and the actualization of abundant size, while compounds such as testosterone or nandrolone with continued acting esters physique up in the physique to an apparent bulk able of acknowledging anabolic action on their own.


More about:Methandrodtenolone Suppliers
From:Hormones product

What is Stanozolol?

Stanozolol is White or about white apparent powder, odorless. About baffling in water, acrid in alcohol, chloroform, hardly acrid in acetone. Confined stored. This artefact anabolic action of the macho role of able and anemic adverse basis of about 120. For the analysis of a array of accompanying vascular diseases, such as Behcet's affection (Behcet syn-drome) in the vascular phenomena, ancestral angioneurotic edema, Raynaud's syndrome, apparent thrombophlebitis, venous ulcers . Can be acclimated for abiding crumbling disease, osteoporosis, and analysis with advance hormone Turner affection accepted (Turn-erssyndrome). Adverse reactions with Nandrolone.

Clinical application:
Female patients advised with androgens or anabolic hormones, can could could cause adult phenomenon, such as hirsutism, a continued beard, complete thicker and low tone, acne, usually in abandonment affection may gradually subside. Macho patients with abiding use of this chic of hormones, drugs may be adapted to estrogen in the body, and may arrest gonadotropin beard acquired testicular decline and inhibition of spermatogenesis; due to abolishment of autogenous testosterone production, can advance to impotence; Children's abiding appliance androgens, can actively affect advance and development, such as dispatch acting on epiphyseal cease can still abide for several months afterwards stopping; appliance anabolic hormones, can advance to obesity. 17 There are α-methyl androgen furnishings on the alarmist accident is added austere arrest with intrahepatic acerbity capillary above excretory function, so that the axial lobular capillary cholestasis in acerbity duct, causing cholestatic alarmist corpuscle damage, analytic manifestations of acerbity cholestatic hepatitis. Abiding use of androgen, may be alarmist cancer, prostate blight and renal corpuscle carcinoma. In addition, because there is sodium assimilation effect, can could could cause edema. Acclimated with attention in patients with branch ache and affection failure, abundant women were banned for prostate cancer

Adverse reactions:
1. Women: Abiding use may accept acne, hirsutism, clitoral hypertrophy, amenorrhea, or menstrual disorders embolism.

2. Male: Abiding use may accept acne, decreased sperm, berry reduced.

3. Liver: GOP, GTP increased, jaundice.

4. Digestive system: nausea, vomiting, dyspepsia, diarrhea.

5. Electrolytes: sodium assimilation and edema. 6. Skin: rash, facial flushing.


More about:Stanozolol Prices
From:Hormones product