About clove oil products

Clove oil is a tropical Southeast Asian origin of medicinal plants spices fragrant myrtle cordingly child is an alias chicken tongue clove aroma, clove, Ding of incense; public clove, mother cloves), scientific name (Eugenia caryophyllata.) refining and came as a pale yellow or colorless clear oily liquid, with special aroma of cloves gas. Exposed in air or stored course of time, then gradually thick and pale brown (see right). Insoluble in water, soluble in alcohol, ether, or glacial acetic acid. Specific gravity of 1.038-1.060.

Cloves, evergreen tree, up to 10 meters. Leaves opposite; petiole obvious; leaf blade oblong-ovate or oblong obovate, 5-10cm, width 2.5-5cm, apex acuminate or acute, base narrow down often develop into a pattern, entire. Fragrant flowers, into the top students thyrses, flower diameter of about 6mm; calyx hypertrophy, green, turn purple, tubular, apex 4 lobed, lobes triangular; corolla white, slightly purple, short tube volt, 4-lobed; stamens most, anthers diastema; ovary, and calyx tube Hopson, style thick, stigma is not obvious. Berries red-brown, rectangular oval, 1-1.5cm, diameter 5-8mm, apex persistent sepals. Seed rectangle.
With side:
1 hiccup cure stomach and vomiting worse: clove oil, rub thoroughly in the hospital. 2 rule chills stomach: clove wine kimono. 3 Warm pubic region, in addition to watery diarrhea: clove oil painted warm umbilical Plaster. 4. Bulk swelling ruffian: clove oil painted navel. 5. Governance arthralgia: clove oil rubbed raw. 3. Cure bad breath: clove oil wipe teeth. 5 Solution crab poisoning: a drop of clove oil, served with ginger. (1 party following a "Checklist Supplements") 8. Governance infestation toothache (non-inflammatory pain): a little clove oil, cotton balls dipped in a small, embedded within a wormhole.


More about:clove oil manufacturer
From:Natural herbal extracts

Melanotan II Acetate basic information

CAS Number: 121062-08-6
English name: Melanotan II
English Synonyms: MT2; MTII; MT-Ⅱ; Melanotan Ц; Melanotan 2; MalanotanIi; MELANOTAN II; Mt-Ii (Melanotan); MelanotanAcetate; Melanotan Ⅱ Acetate
Chinese name: Melanotan II
Chinese Synonyms: America melanin; Melanotan 2; America that Nuotan II; Melanotan II; acetate Melanotan 2; acetate Melanotan II; acetate Melanotan acetate; acetate Merano Tan Ⅱ MELANOTAN Ⅱ ACETATE; acetate Melanotan Ⅱ MELANOTANII ACETATE (MT-2)
CBNumber: CB9213757
Formula: C50H69N15O9
MW: 1024.18
MOL File: 121062-08-6.mol
Melanotan II chemical properties
Density: 1.43
Storage conditions: -20 ° C
Solubility: H2O: 5 mg / mL, soluble
form: solid
CAS databases: 121062-08-6 (CAS DataBase Reference)


More about:Melanotan II Acetate suppliers
From:natural food additive

Magical Argireline Acetate (Acetyl Hexapeptide-3)

Argireline Acetate (Acetyl Hexapeptide-3) from the Antarctic Bay Bing Heni found in the concentration of bacteria called unicellular green bacteria are developed six yuan peptides, and completely MP clean room production process that produced potent polypeptide protein; this bioactive peptides hexagonal, effective relief and inhibit forehead wrinkles, fine lines and the surrounding fish eye muscle contraction and activities to help relax the muscles, so that the skin supple and elastic tissue to restore smooth line.
It has a similar inhibits neurotransmitter, blocking neuromuscular conduction function, to avoid excessive muscle contraction, can prevent the formation of fine lines. Six yuan peptides can reduce the strength of muscle contraction can be slow, let the muscles relax, reduce the dynamic pattern of occurrence and elimination of wrinkles; effectively reorganize collagen elastin, can increase the activity of elastin, so relax facial lines, wrinkles and smoothes improve relaxation. Can be used in cosmetics as an anti-wrinkle ingredients, and excellent results.
Argireline is a class of botulinum toxin components, with all the features of botulinum toxin, which does not contain any toxic, non-toxic substances. The main ingredient is composed of six amino acids arranged in a combination of biochemical products. While Botox is often compared and their mechanisms are completely different. Six peptides can intercept signals of muscle contraction to reduce the force of muscle contraction, thereby improving the depth and length of fine lines. It has become a place of striking beauty Botox darling. Swiss Legend Group skincare R & D Labs in 2010 Magic MAGIC CARE Care six peptides (like Botox) wrinkle firming peptide stock solution is six representatives tip of beauty products.


More about:Argireline Acetate(Acetyl Hexapeptide-3) suppliers
From:natural food additive

Salcitonin Acetate Introduction

Calcitonin is the regulation of calcium metabolism, parathyroid hormone inhibition of one, it can significantly reduce the high turnover bone disease of bone loss, such as osteoporosis, deformed bone disease (Paget's disease), pain nerve dystrophy (Sudeck's disease) and malignant osteolysis syndrome, its postmenopausal osteoporosis bone torso more significant effects than limbs and high turnover bone disease than the low turnover bone disease more pronounced. Can inhibit osteoclast activity, and stimulation of osteoblast formation. Calcitonin also inhibits osteolysis, so pathologically elevated blood calcium concentration is reduced, and by reducing the increase tubular reabsorption calcium, phosphorus and sodium excretion, serum calcium but does not fall below the normal range . Calcitonin inhibition of gastric and pancreatic secretory activity, but does not affect the stomach and intestines. Clinical trials prove that the product of some painful bone disease in patients with analgesic effect. All calcitonin structurally similar, with a single chain of 32 amino acids arranged differently. Sequence of amino acids depending on the species. Salmon calcitonin its receptor with high affinity binding site (receptor binding site of its central nervous system has been shown in certain regions), with a very good clinical results and ratio combining mammals (including humans) calcitonin, effect lasted longer.
Salcitonin Acetate indications:
1, disabled, or can not use conventional estrogen combination therapy with calcium preparations early and late postmenopausal osteoporosis and senile osteoporosis.
2, secondary to breast, lung or kidney cancer, myeloma and other malignant hypercalcemia caused by bone metastases.
3, Paget's disease.
4, hyperparathyroidism, lack of activity or vitamin D intoxication (including acute or chronic toxicity).
5, painful nerve dystrophy or Sudeck's disease.

More about:Salcitonin Acetate suppliers
From:natural food additive

What is Oxytocin Acetate and the effects on the fetus

Oxytocin also known as Oxytocin Acetate is a pituitary neurohormone, is commonly referred to as "birth needle" [1], the supraoptic nucleus and paraventricular nucleus of the giant cell manufactured by the hypothalamic-pituitary axis transported to the nerve fibers to the posterior pituitary secretion, and then released into the blood. Mainly used in clinical birth abortion, postpartum bleeding and shortened third stage of labor. Besides a wide range of physiological functions, especially the role of the central nervous system.
Oxytocin is a hormone produced in the brain, both men and women. In women, it can cause uterine contractions during childbirth and stimulate milk secretion, and through maternal affection between mother and child to establish contact. In addition, it also reduces the human body such as stress hormone corticosterone levels, lower blood pressure.
Oxytocin stimulate the secretion of breast and uterine contraction dual role to stimulate breast-based, its physiological role and regulation of secretion described below.
Oxytocin is a close relationship between people's origins, the reason why people are eager to embrace love kissing precisely because oxytocin at work. Oxytocin levels rise when the body, it will subsequently be able to release a lot of stress relief, anti-aging hormone, better promote cell regeneration.
Effects on the fetus: oxytocin can be selectively excited uterine smooth muscle, causing contraction of the uterus, is a strong uterine contractions agent, mainly used for oxytocin, induction of labor and the prevention of postpartum hemorrhage. Intravenous infusion of oxytocin effect occurs 1 minute, so the speed can be adjusted to control the dose infusion, thereby controlling the intensity of uterine contractions. In childbirth if they can properly use, you can play a good induction or strengthen the role of uterine contractions, also known as birth role in the clinical application is extremely broad. But the application of oxytocin, it must be strictly medication methods, including the route of administration, medication velocity and concentration, with or without medication contraindications psychosis.
Oxytocin drug itself is not much impact on the fetus, but if oxytocin infusion rate is too fast, too much administration, may cause tonic or spasmodic contraction of the uterus, due to continued strong contraction of the uterus but not diastolic or diastolic very short time because of the birth canal stenosis or fetus is too large, malposition, etc., hinder the fetus, and the result caused by the lower uterine segment thinner and eventually rupture, causing bleeding pregnant women, fetal hypoxia. Or as a result of the above cause strong uterine contractions, childbirth without too much resistance when the fetus was delivered quickly, the entire production process is not more than three hours, called radical production. This will disinfect because of too late to protect the perineum, resulting in postpartum infection, birth canal laceration, neonatal fall injuries and other consequences. And if the contractions of long duration, intermittent short or without intermittent, affecting placental blood circulation, can easily cause acute fetal hypoxia, causing stillbirth or neonatal asphyxia


More about:Oxytocin Acetate suppliers
From:natural food additive

Bivalirudin Trifluoroacetate role

Bivalirudin Trifluoroacetate role with heparin, it does not rely on antithrombin 1V (NI1_ Ⅳ), heparin cofactor Ⅱ and so on. Thrombin plays a central role in the coagulation serine protease: it is the hydrolysis of fibrinogen to generate fibrin monomers; activation of coagulation factor X Ⅲ; promote crosslinking of fibrin clots to form a stable covalent structure. Meanwhile, thrombin activates factor V, Ⅷ; activates platelets promote platelet aggregation and granule release. This product can be hydrolyzed due to thrombin peptide sequence Arg3 and Pro4 peptide bond between, so that the product inactivation, so the product of thrombin inhibition is reversible and transient. In in vitro experiments, the product concentration-dependent manner to extend the healthy human plasma activated partial thromboplastin time (activated partial thromboplastin time, af T), thrombin time (thrombin time, 1vr), prothrombin time (prothrombin time, PT ). The goods and the free thrombin or thrombus thrombin binding without affecting platelet release substances. Trial in healthy volunteers show: This product dose and concentration-dependent manner activated clotting time extension (activated clotting time, ACT), af Ding, Prr and 1vr. Due to vascular occlusion ≥ 70% while receiving percutaneous transluminal coronary angioplasty (PTCA) in patients with coronary heart disease treatment given after the product is also available with the same anticoagulant effect of healthy people. In the generation after intravenous anticoagulant effect of this product, the patient's coagulation in about 1 h after discontinuation tended to be normal. 291 cases due to vascular occlusion greater than 70% while receiving PTCA in patients treated with the dose increased, the majority of patients with ACI, time to reach the 300 or 350S. iv 1 mg'kg this product, combined 2.5 mg · kg · h infusion for 4h, and then 0.2 mg · kg · h dose to maintain 14 to 20h, all patients A (vr values ​​exceed 300S.

More about:Bivalirudin Trifluoroacetate suppliers
From:natural food additive

Some information about Histrelin Acetate

Histrelin Acetate is an effective, long-lasting and synthetic non-peptide gonadotropin-releasing hormone analogues. It is more than endogenous gonadotropin-releasing hormone more effective. Long-term use of gonadotropin-releasing hormone agonists can reduce the number of pituitary gonadotropin receptors, also inhibits gonadotropin receptor stimulation. In the ovary, gonadotropin-releasing hormone agonist suppression steroid substances produced and reducing the number of gonadotropin receptors. Histrelin Acetate for central precocious puberty. Give proper daily dose of histrelin with central precocious puberty in boys make gonadotropin levels fall and testicular nucleic acids decrease. The girl in serum estradiol concentrations decreased to prepubertal levels, cessation of menstruation, linear growth, skeletal maturation and adult slow increase in height.

There are some indications that melatonin is involved in puberty. Nevertheless, with the Histrelin Acetate central precocious puberty in girls with estrogen reduced, but did not decrease the concentration of melatonin.

Indications:
For the treatment of central precocious puberty. Can also be used to treat endometriosis, polycystic ovarian disease, uterine leiomyoma. Also with estrogen or progesterone combined therapy of severe pre-menopausal syndrome. FDA alone can prevent acute intermittent porphyria.

Adverse reactions:
Clinical Trials common adverse reactions were injection site skin reactions (erythema, swelling and itching), vaginal bleeding, urticaria, purpura, convulsions frequency increases, visual clutter, hot flushes / flushing, swelling, mood changes, and behavioral disorder and fever , limb pain, fatigue, chills, malaise, neck, chest or trunk pain and viral infections, weight gain, head / facial pain, nausea and vomiting.

Contraindications:
Pregnant or potentially pregnant women and lactating women disabled histrelin. Hypersensitivity reaction to the drug people are disabled.



More about:Histrelin Acetate suppliers
From:natural food additive

GRF (human) Acetate basic information

Chinese name: Growing releasing hormone
Chinese Synonyms: Growing releasing hormone; promote release of adrenaline factor; acetic acid pro adrenaline-releasing factor (human); promoting adrenaline-releasing factor (human); TYR-ALA-ASP-ALA-ILE-PHE-THR-ASN-SER-TYR-ARG-LYS-VAL-LEU-GLY-GLN-LEU-SER-ALA-ARG-LYS-LEU-LEU-GLN-ASP-ILE-MET-SER-ARG-GLN-GLN-GLY-GLU-SER-ASN-GLN-GLU-ARG-GLY-ALA-ARG-ALA-ARG-LEU-NH2; GRF (human) Acetate
Name: GRF (1-44) (HUMAN)
English Synonyms: SERMORELIN (HUMAN); SOMATOCRININ (HUMAN); SOMATOLIBERIN (HUMAN); SOMATORELIN; YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL-NH2; TYR-ALA-ASP-ALA-ILE-PHE-THR-ASN-SER-TYR-ARG-LYS-VAL-LEU-GLY-GLN-LEU-SER-ALA-ARG-LYS-LEU-LEU-GLN-ASP-ILE-MET-SER-ARG-GLN-GLN-GLY-GLU-SER-ASN-GLN-GLU-ARG-GLY-ALA-ARG-ALA-ARG-LEU-NH2; H-TYR-ALA-ASP-ALA-ILE-PHE-THR-ASN-SER-TYR-ARG-LYS-VAL-LEU-GLY-GLN-LEU-SER-ALA-ARG-LYS-LEU-LEU-GLN-ASP-ILE-MET-SER-ARG-GLN-GLN-GLY-GLU-SER-ASN-GLN-GLU-ARG-GLY-ALA-ARG-ALA-ARG-LEU-NH2; H-TYR-ALA-ASP-ALA-ILE-PHE-THR-ASN-SER-TYR-ARG-LYS-VAL-LEU-GLY-GLN-LEU-SER-ALA-ARG-LYS-LEU-LEU-GLN-ASP-ILE-MET-SER-ARG-GLN-GLN-GLY-GLU-SER-ASN-GLN-GLU-ARG-GLY-ALA-ARG-ALA-ARG-LEU-OH
CAS: 83930-13-6
Formula: C215H358N72O66S1
MW: 5039.65
EINECS Number:
Related Categories: Peptide; peptide APIs; Peptide; VIP and PACAP receptor
Mol File: Mol File
The nature of the growth hormone release
Storage conditions -20 ° C



More about:GRF (human) Acetate suppliers
From:natural food additive

Some of the role of Endothelin 1

Endothelin (endothelin, ET) exists not only in vascular endothelium, is also widely present in various tissues and cells, is an important factor in regulating cardiovascular function, based on the maintenance of vascular tone and homeostasis plays an important role in the cardiovascular system. It is a polypeptide composed of 21 amino acids, a molecular weight of 2400D, N terminal position of the two cysteine ​​disulfide to connect 1-15,3-11, C is the number of hydrophobic amino terminal residues. N-terminal structure determines its receptor affinity, C-terminal receptor binding to determine their position. ET-1 and two isomers of the family that ET-2, ET-3, the difference is the individual amino acid residues play a major role in the cardiovascular is ET-1 (Endothelin 1). Endothelial cells are stimulated synthesis and release of ET-1, which is mainly regulated at the transcriptional level, stimulating ET-1 synthesis include: epinephrine, thromboxane, vasopressin, angiotensin, insulin, cytokines, and vascular wall shear force and the pressure change and the physico-chemical factors such as hypoxia, ET-1 stimulation of the synthesis process requires a Ca2 (-dependent protein kinase C (PKC) involved. inhibition of ET-1 synthesis factors: NO, PGI2, Atrial natriuretic peptide and heparin. ET-1 in plasma half-life is very short (<5min), quickly binds to receptors on the organization, its clear position mainly in the lungs and kidney, ET-degrading enzymes will soon be decomposed .

Role: endothelin (Endothelin, ET) is a Japanese scholar Yanagisawa, etc. from cultured porcine aortic endothelial cells, a kind of isolated and purified by a 21 amino acid residues of the peptide, endothelin is by far the most powerful vasoconstrictor known substances, their duration of action lasting, not for  receptors, H1 receptors and 5-HT receptor antagonist antagonist, may be isoproterenol, atrial natriuretic peptide and calcitonin gene-related peptide hormone suppression. Thus, endothelin is an endogenous vasoconstrictor long-acting regulatory factors. Endothelin there is a strong positive inotropic effect and vasoconstrictor reflex rise of blood pressure effects can also cause heart suppression, resulting in cardiac insufficiency. But also induced myocardial cell sugar overload, arrhythmias, and myocardial energy metabolism. Currently a large number of studies have shown hinder severe angina, AMI, myocardial 1 / R injury, percutaneous transluminal angioplasty ET synthesis and release of the body to increase significantly hinder, or vascular reactivity for ET hyperthyroidism, are likely to promote the development of the pathological process. The application of ET or ET antagonist antibody may be ischemic heart disease prevention.

Impact: The discovery of endothelin people on endothelial cells to further deepen the understanding that the endothelium is not only a semi-permeable membrane to maintain blood flow and exchange of material, is also a specialized regulatory organization, plays a signal receiving, processing and re-export of role for the maintenance of homeostasis plays an important regulatory role in circulation. Studies have shown that tissue hypoxia, oxidative metabolism can be enhanced and increased levels of catecholamine stimulation of endothelin original transcription. Angiotensin can promote the release of endothelin. In the heart and blood vessels have extensive endothelin receptors, endothelin receptor binding and tissue corresponding to activate the second information cGMP, secondary to increased levels of inositol triphosphate-induced increase in intracellular calcium, and exerts its biological effects .



More about:Endothelin 1 suppliers
From:Cytokines products

Testosterone decanoate some of the information

Abstract：We have investigated the pharmacokinetics and effects on the male reproductive axis of a novel preparation of testosterone decanoate (TD) with a progestogen implant. Twenty healthy Chinese men were administered TD (400 mg intramuscular 4 weekly) with two subcutaneous (SC) etonogestrel implants. Trough testosterone concentrations rose with repeated administration. Peak concentrations 1 week after the fourth injection were 31 +/- 2 nmol/liter. Both LH and FSH were rapidly suppressed and continued to fall during treatment. Spermatogenesis was also suppressed, to <or=1 x 10(6)/mL in all men with 16 (80%) azoospermic at 12 weeks. Treatment was associated with an increase in weight, and also increases in hemoglobin concentration (9%) and hematocrit (15%). No subjects withdrew from the study, although the study was terminated after subjects had completed 12 to 18 weeks as some men were found to have elevated liver enzyme tests. These data demonstrate that the pharmacokinetics of TD are improved compared to previous injectable testosterone preparations, although peak testosterone concentrations rise briefly into the supraphysiological range. The speed and degree of spermatogenic suppression suggest that this combination has promise as an effective male contraceptive.

More about:Testosterone decanoate Prices
From:Hormones product

About Methandrodtenolone Products

Methandrostenolone (trade names Averbol, Dianabol, Danabol), aswell accepted as metandienone (INN) or methandienone, is an orally-effective anabolic steroid originally developed in Germany and arise in the US in the aboriginal 1960s by Ciba Specialty Chemicals. Methandrostenolone is a controlled actuality in the United States and Western Europe and charcoal accepted a part of bodybuilders. An injectable anatomy is awash online from United States based companies. Methandrostenolone is readily accessible after a decree in countries such as Mexico (under the barter name Reforvit-b), and is aswell getting bogus in Asia and abounding East European countries.

Biophysiology:

Methandrostenolone does not acknowledge acerb with the androgen receptor but still exerts its furnishings through the androgen receptor in vivo.[4] These cover affecting increases in protein synthesis, glycogenolysis, and beef backbone over a abbreviate amplitude of time. In top doses (30 mg or added per day), ancillary furnishings such as gynecomastia, top claret pressure, abscess and macho arrangement alopecia may activate to occur. The biologic causes astringent masculinising furnishings in women even at low doses. In addition, it is metabolized into methylestradiol by aromatase. This agency that after the administering of aromatase inhibitors such as anastrozole or aminoglutethimide, estrogenic furnishings will arise over time in men. Abounding users will action the estrogenic ancillary furnishings with Arimidex, Nolvadex or Clomid. In addition, as with added 17α-alkylated steroids, the use of methandrostenolone over continued periods of time can aftereffect in alarmist accident after adapted care.

The 17α-methylation of the steroid does acquiesce it to canyon through the alarmist with alone a baby allocation of it torn down (hence causing the above accident to the liver) acceptance it to be able if taken orally. It aswell has the aftereffect of abbreviating the steroid's affection for sex hormone bounden globulin, a protein that de-activates steroid molecules and prevents them from added reactions with the body. As a result, methandrostenolone is decidedly added alive than an agnate abundance of testosterone, consistent in accelerated advance of beef tissue. However, the accessory acclivity in estrogen levels - a aftereffect of the aromatization of methandrostenolone - after-effects in cogent baptize retention. This gives the actualization of abundant assets in accumulation and strength, which prove to be acting already the steroid is discontinued and baptize weight drops. Because of this, it is generally acclimated by bodybuilders alone at the alpha of a "steroid cycle", to facilitate accelerated backbone increases and the actualization of abundant size, while compounds such as testosterone or nandrolone with continued acting esters physique up in the physique to an apparent bulk able of acknowledging anabolic action on their own.


More about:Methandrodtenolone Suppliers
From:Hormones product